PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G191300.1
Common NamePHAVU_011G191300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 555aa    MW: 61028.7 Da    PI: 5.2281
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G191300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-183784148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed++lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Phvul.011G191300.1 37 KGPWTSTEDDILVDYVNKHGEGNWNAVQKHTGLLRCGKSCRLRWANHL 84
                        79******************************99**********9986 PP

2Myb_DNA-binding48.42.2e-1590133146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE+  ++++++++G++ W++ a++++ gRt++++k++w++
  Phvul.011G191300.1  90 KGAFTAEEERFIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5743284IPR017930Myb domain
SMARTSM007171.4E-143686IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-2936131IPR009057Homeodomain-like
PfamPF002494.1E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-233890IPR009057Homeodomain-like
CDDcd001672.45E-113984No hitNo description
PROSITE profilePS5129424.5385139IPR017930Myb domain
SMARTSM007178.5E-1689137IPR001005SANT/Myb domain
PfamPF002491.3E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2491138IPR009057Homeodomain-like
CDDcd001672.42E-1192133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MRRVSNEIED EVLPSDLSAA QLNDESYEGS TSIVLKKGPW TSTEDDILVD YVNKHGEGNW  60
NAVQKHTGLL RCGKSCRLRW ANHLRPNLKK GAFTAEEERF IAELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPEV CLQGFQESQR NQSNGGLNGG DKMHLDLLQT  180
NSYEIHGAIF DSLKDNQGIL PYAPKFPDAS VYGNMLKGLD SSQYCSVMTP ASPKHKRLRE  240
STIPFIGSND TRKNGLYPFS QIRDNNSDKI AQSFGMQALL DPGPSSHNSM CYSHSLSNGN  300
SSTSKPTFEA VKLELPSLQY PELDLGSWGT SPPPPLLESV DDFFQSPTPI STLESDCSSP  360
QNSGLLDALL YQAKTLSSSK NHCSDKSSNS STATPGDRGD SSALNVYETE WEDYADPVSP  420
FGATSILNEC PALLRASENS LDEQLSFQAF TGNIPKLEFV DQVWTPESEN QTLSLLNFTR  480
PDFLFASDWH DLGSGNGKNQ AITTDTTMTL LGDHFASDRK HMTSGTSQSS QVWGFGSCAT  540
ANNMPALCQL SDLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5258970.0KC525897.1 Glycine max GAMBY1-like family protein (GAMYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133583.10.0hypothetical protein PHAVU_011G191300g
TrEMBLV7AIZ80.0V7AIZ8_PHAVU; Uncharacterized protein
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-117myb domain protein 33